- Recombinant Drosophila ananassae Vacuolar ATPase assembly integral membrane protein VMA21 (GF10347)
- MyBioSource.com
- Pricing InfoSupplier PageView Company Product Page
- MBS1112113
- 1 mg (E Coli Derived)
- This item requires custom production and lead time is between 5-9 weeks. We can custom produce according to your specifications
- >90%
- Recombinant Protein
- 11,606 Da
- E Coli or Yeast
- 1-106
- dana_GLEANR_10302, GF10347
- Vacuolar ATPase assembly integral membrane protein VMA21 (GF10347)
Sequence
MSNKNKKSGGAGNGAAQKQTRQQSHDSQDYSSFKIVLFYCMLIVFLPVVTFFLLKGFVLDRFFSLSEVKVNIASAVGAVVSLHIALGLYIYRAYFGATGSKAVKED